PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P04400_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 1702aa    MW: 186247 Da    PI: 6.8763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P04400_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.29.2e-09799840346
                            SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            +W+++E +++ +  +++G++ +++I++ ++ ++t  +c+++++k
  GSMUA_Achr9P04400_001 799 PWSEDEKDIFMEMLARYGKD-FTKISSSLN-HKTTADCIEFYYK 840
                            8*****************99.*********.***********98 PP

2Myb_DNA-binding27.66.8e-0910111050445
                             S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                             WT eE  ++++a   + ++ +++I+++m  +R+++qck ++ 
  GSMUA_Achr9P04400_001 1011 WTDEEKSIFIQALGTYDKD-FTKISSCMR-TRSREQCKIFFS 1050
                             *****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-13784846IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-5792843IPR009057Homeodomain-like
PROSITE profilePS5129315.014795846IPR017884SANT domain
SMARTSM007172.3E-9796844IPR001005SANT/Myb domain
PfamPF002491.1E-7799840IPR001005SANT/Myb domain
PROSITE profilePS5129313.84610061057IPR017884SANT domain
SMARTSM007171.7E-810071055IPR001005SANT/Myb domain
SuperFamilySSF466893.35E-1010081057IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-510101051IPR009057Homeodomain-like
CDDcd001674.08E-710111049No hitNo description
PfamPF002495.5E-710111049IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1702 aa     Download sequence    Send to blast
MPPEPLPWDR KEYAFKDQRK HERGDALGGG GGGGSSSASR WKDPYHGGPR DLLRASPRRP  60
FSSHCRQGGG YHQVHPDDSV GHGCTPSRSD RFWSEDDGYR PASVRHGGCY RTSSSGSSRE  120
NRGSFRRSPC WDSGDFSRQH RHDPHATALR SVAAPISSTS QIPLKEQNDK TGGVDDGLGT  180
GHIFDHRDHS LGSIPWKKWS RPGSLGFTKT SRSESEEACL EGVLPSGKEN PIQSLVTLTL  240
PPDEVAPRKK PRLGWGQGLA KYEKQKVEGS VETSVGGSKG SLSDDSQKVT SISGCLSPTT  300
PCSATCSSSP GTEDKLCSRT VNDYDGMNQN SDLPGSAFLS FCEEISNNLD HLEANPIRSL  360
DSLLTDLFQS VDAFSGDSTF SRDSALNKLL KLKGSISNGL EKIECEIDLL EKELKSLNCD  420
TKTDSYQSSV KLANDSALEA CIQPLAGLSD ESNPSKDQKV ETIEVAFVEE HVPCGSLVKH  480
DTVIKDIYII NPETLSSKFH LAIEKLSESP LLIKDEKLKV TELQQIVDSD CGERIMVASE  540
DGNRNCGDGD CSSVHVSFDE ATQGKDSNLI TSIIDSNMNA AKCASKVFGT AFSTNPLLSD  600
IWGLVNFTSC RKNDLKIKEK LATRKCQLRF KERVLILKFK ALHHLWKEDL RLLSIKKVRT  660
KSSKRFELMS RSSQNGSQKQ RSSTRSRFAS PVAGWVFSLD YVVAIMIRTD FFLTTVVLFL  720
FFKKRRKLIG NLTLVPTTEI VNFTSKLLSD AQIKLCRNNL KMPTLLLDDK ERKYNKFVTQ  780
NGLIKDPPSF EKERAMINPW SEDEKDIFME MLARYGKDFT KISSSLNHKT TADCIEFYYK  840
NHKSESFKEV KKWLDLRKQQ QQCLPANTYL VASGKKWNHE MNASSLDMLG AASAVVAHDH  900
CSSKSEKYAG SAVYGTCNDM KVSYGSSYLE GENSVDVSGQ ERDFVAADVL AGICGALSSE  960
TMSSCVTSFI HPAERINRIT MDQLLTPEVT QNLDEEEACS DEGCELGSAD WTDEEKSIFI  1020
QALGTYDKDF TKISSCMRTR SREQCKIFFS KARKCLGLDV IRQGTVLGGT PLSDANGGRS  1080
DTDDACVAEM DSAICSTQSC SKVDVDVSQS VANTSYEGIA HAAGNPFHAE TDRSNEQDGD  1140
VFPGPNLVAD SADRETIVGG NTNVVSPNVS ILTIGKTEPV VEACLEVEST KSTSSTVCNV  1200
DTTGGSPAEG LKVVVKTEAS LSSKVGLSKK NTTNINLTAN GKGLLCCGPD SNASAAALFS  1260
GTVANVCHLA FDPRYQQQIQ LDLQQRKPKQ PQAILLKQEN VHHVPLNSLL PDPSSICFGG  1320
TLNVSSETTL NFEQGNKWHQ NLLKRGIYQQ YMPRKLSVNQ VDRNMHILRG YPLQALSQDV  1380
TREVDLTAGE KPSLLEAECK TNVVPQSNQF FMSDKHWNEN NLLPSNSGIL RSSRSENQSE  1440
VEIRTCIKNA SSEIEEHRTG DVKLFGKILS HTSPLPQSSS SSHESNPRTS PELDGSSTTN  1500
CASIRRDNHR LVPNIGSGQV GLEALPVRTY GFWDGKRRQT GFSSLPETAS MLAKYQGSLT  1560
GVSLYSAKDG MPSGNGVLTD YQQSYVQHLS SNGKRVENIS ELQKRNGGME MVSGFQQQGR  1620
VAPLGAKNMM GGGILVGGGG GVSDPVAALK MHYAARASTL NNNIEAWRAD MGDRTKVCNT  1680
ISYQCFEVGS IQYGTNVPSD TS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D3e-15762848994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C3e-15762848994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1722726KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009416283.10.0PREDICTED: uncharacterized protein LOC103996938 isoform X1
TrEMBLM0TXE90.0M0TXE9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P04400_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-103MYB family protein